PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3365s0017.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 413aa    MW: 45568.2 Da    PI: 6.2823
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3365s0017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.6e-33228282155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav++LGGse+AtPk +l++mkv+gLt++hvkSHLQkYR+
  Araha.3365s0017.1.p 228 KARMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRT 282
                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.291225285IPR017930Myb domain
SuperFamilySSF466895.91E-17227282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-31227284IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-24228282IPR006447Myb domain, plants
PfamPF002494.5E-9230281IPR001005SANT/Myb domain
PfamPF143792.8E-24316359IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MEARPVQRSG SRELSSNLAR TSSIPSTQKP SAAEDSFIRS ENNTQLMSRQ LGQSYHLLSS  60
SNGGAVGHIC SSSSSGGFSN NLHYSTMVSH EKQHYAGSSS NAAQTPSNDS SWCHDSLPGG  120
FLDFHENNNP AIQNNSQIED GGIAAAFDDI QKRSDWHEWA DHLITDEDPL MSTNWNDLLL  180
ETSSNSDSKD QKSLQIPQPQ IVQQQPSPSV ELRPVSTTSS NSNNGTGKAR MRWTPELHEA  240
FVEAVNSLGG SERATPKGVL KIMKVEGLTI YHVKSHLQKY RTARYRPEPS ETGSPEKKLT  300
PLEHITSLDL KGGIGITEAL RLQMEVQKQL HEQLEIQRNL QLRIEEQGKY LQMMFEKQNS  360
DLAKGTASTS DSAAKSEQKD KKSADSKVVA EEETRKCEEP ESPQPKRPKT DN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3107990.0AJ310799.1 Arabidopsis thaliana mRNA for phosphate starvation response regulator 1 (phr1 gene).
GenBankJN0098020.0JN009802.1 UNVERIFIED: Lupinus polyphyllus phosphate starvation response regulator-like mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867442.10.0hypothetical protein ARALYDRAFT_491902
SwissprotQ8GUN54e-77PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLD7MDA50.0D7MDA5_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.7__1335__AT4G28610.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.10.0phosphate starvation response 1